PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009803488.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family GRAS
Protein Properties Length: 686aa    MW: 75446 Da    PI: 6.3049
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009803488.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS279.69e-863256853374
            GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshlt 97 
                     ++++++ e + +g++++aq +Larl+++ sp g+p++R+a+yf+eAL+   +   + ++ ++pp+  ++ + + ++ a+k+fsevsP+++f ++t
  XP_009803488.1 325 DQIFQASELLLAGHFSNAQMILARLNQQLSPIGKPFKRAAFYFKEALQLPFLL--PCTSTSFPPRIPTPFDCVLKMDAYKAFSEVSPLIQFMNFT 417
                     67899999999*************************************99998..7777889****9999************************* PP

            GRAS  98 aNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrle..dle 190
                      NqaIlea+  ++++HiiDfdi+ G+QW +++q+L s ++++ sl+iT+++sp+++++ e+  ++e L+ fA+ +g++fe +v+  ++++  +  
  XP_009803488.1 418 SNQAILEALGDAKQIHIIDFDIGCGAQWSSFMQELPSSNRKATSLKITAFVSPSTHHSVEIGIMHESLTLFANDVGIRFELEVINLDSFDpkTYP 512
                     ***********************************************************************************977765411567 PP

            GRAS 191 leeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsl.eaklpreseerik 284
                     l++Lr ++ Ea+a+n+ +   +      +     +++L+++k+lsPkvvv  e+ +++++ ++ +++l+al+yy  l+ s+ +a+   + +  +k
  XP_009803488.1 513 LSSLRSSECEAIAINFPIWSISSC--LFA----FPSLLHCMKQLSPKVVVSLERGCERTELPLKHHLLHALQYYEILLASIdAAN--LTPDVGKK 599
                     8999************99555444..344....456*********************************************5555..4778999* PP

            GRAS 285 vErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                     +Er ll+ +i+n+v  + ++     ++   Wr+ + +aGF+pv++s+ ++ qa++l++++++ g++ve+++ slvl+Wk+++L+s+ +Wr
  XP_009803488.1 600 IERSLLQSSIENMVLGRLRS----PNRIPPWRNLFASAGFSPVAFSNLTEIQAECLVKRTQVGGFHVEKRQTSLVLCWKQQELLSALSWR 685
                     ***************99988....999**************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098541.622297665IPR005202Transcription factor GRAS
PfamPF035143.1E-83325685IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 686 aa     Download sequence    Send to blast
MIVIPQSNNL AGAKGVLGVS MLDARSPSPS ASSSSCSYGG QYAGNNGVPG AGAGKIDGRK  60
EELVTELQPF SFELEPEKFN LGFGDLDNLL PELAGSDQTI FRWISGDMED PSVSLKQLLQ  120
GGNANADLGC GVSVAGSFAC TDNISFSSSD ISLDANIEKI GSVVIDSNNR PNNNFENPNV  180
NLLAKSLPPT LSFHEQQSEE KPQISCPQIM TNQHQFQNSA YVNLFGSSSY NMNQEQPPPK  240
RHNSGILGSS LGFLLPKVPF FNPSGDLLLR KQPLGHMQQQ VNLLPPHQFQ PTSLFVPKLE  300
AAGGDGNGNL MVPRHQQQEQ QFIYDQIFQA SELLLAGHFS NAQMILARLN QQLSPIGKPF  360
KRAAFYFKEA LQLPFLLPCT STSFPPRIPT PFDCVLKMDA YKAFSEVSPL IQFMNFTSNQ  420
AILEALGDAK QIHIIDFDIG CGAQWSSFMQ ELPSSNRKAT SLKITAFVSP STHHSVEIGI  480
MHESLTLFAN DVGIRFELEV INLDSFDPKT YPLSSLRSSE CEAIAINFPI WSISSCLFAF  540
PSLLHCMKQL SPKVVVSLER GCERTELPLK HHLLHALQYY EILLASIDAA NLTPDVGKKI  600
ERSLLQSSIE NMVLGRLRSP NRIPPWRNLF ASAGFSPVAF SNLTEIQAEC LVKRTQVGGF  660
HVEKRQTSLV LCWKQQELLS ALSWRC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A8e-2634668526375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF4819520.0AF481952.1 Petunia x hybrida hairy meristem (HAM) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009803488.10.0PREDICTED: scarecrow-like protein 6 isoform X2
TrEMBLQ8LL100.0Q8LL10_PETHY; Hairy meristem
STRINGPGSC0003DMT4000121040.0(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00150.12e-98GRAS family protein